Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PTHLH protein

This Human PTHLH protein spans the amino acid sequence from region 37-175aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PTHLH

UniProt

P12272

Expression Region

37-175aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Isoform 2 of His-tag and expression region is 37-175aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX1 Rabbit Polyclonal Antibody (Fluoro550)
orb3105433 100 µg

PAX1 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Pan-filovirus Chimeric anti-GP mAb
0200-003 100 µg

Pan-filovirus Chimeric anti-GP mAb

Sign In for Pricing
View Details
HER3/ErbB3 Antibody
BF0257-01 50 µL

HER3/ErbB3 Antibody

Sign In for Pricing
View Details
HER3/ErbB3 Antibody
BF0257-02 100 µL

HER3/ErbB3 Antibody

Sign In for Pricing
View Details
HER3/ErbB3 Antibody
BF0257-03 200 µL

HER3/ErbB3 Antibody

Sign In for Pricing
View Details
HNRNPAB protein (His tag)
80R-3504 0.05 mg

HNRNPAB protein (His tag)

Sign In for Pricing
View Details