Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PTHLH protein

This Human PTHLH protein spans the amino acid sequence from region 37-175aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PTHLH

UniProt

P12272

Expression Region

37-175aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Isoform 2 of His-tag and expression region is 37-175aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Lysyl Oxidase Like Protein 2
GTR10380433 96 Well

Chicken Lysyl Oxidase Like Protein 2

Sign In for Pricing
View Details
MDM2 Mouse Monoclonal Antibody [Clone ID: OTI7F7]
TA804664 100 µL

MDM2 Mouse Monoclonal Antibody [Clone ID: OTI7F7]

Sign In for Pricing
View Details
MIRacle™ hsa-miR-564 miRNA Agomir/Antagomir
AM1682 2 OD, 4 OD, 50 OD

MIRacle™ hsa-miR-564 miRNA Agomir/Antagomir

Sign In for Pricing
View Details
Rat Slc25a47 Pre-designed siRNA Set B
SI213054B 1 Each

Rat Slc25a47 Pre-designed siRNA Set B

Sign In for Pricing
View Details
ZNF821 3'UTR GFP Stable Cell Line
TU079480 1.0 mL

ZNF821 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
GW7647
HY-13861-01 5 mg

GW7647

Sign In for Pricing
View Details