Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Drosophila pburs protein

This Drosophila pburs protein spans the amino acid sequence from region 21-141aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pburs

UniProt

Q9VJS7

Expression Region

21-141aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Drosophila melanogaster (Fruit fly)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LRYSQGTGDENCETLKSEIHLIKEEFDELGRMQRTCNADVIVNKCEGLCNSQVQPSVITPTGFLKECYCCRESFLKEKVITLTHCYDPDGTRLTSPEMGSMDIRLREPTECKCFKCGDFTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UNC5D-Specific antibody
FNab09264 100 µg

UNC5D-Specific antibody

Sign In for Pricing
View Details
Recombinant Mouse Cys-C Protein (His Tag)
PDMM100251-01 20 µg

Recombinant Mouse Cys-C Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Cys-C Protein (His Tag)
PDMM100251-02 100 µg

Recombinant Mouse Cys-C Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Cys-C Protein (His Tag)
PDMM100251-03 500 µg

Recombinant Mouse Cys-C Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Cys-C Protein (His Tag)
PDMM100251-04 1 mg

Recombinant Mouse Cys-C Protein (His Tag)

Sign In for Pricing
View Details
Celf5 Mouse Gene Knockout Kit (CRISPR)
KN503117 1 Kit

Celf5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details