Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Drosophila pburs protein

This Drosophila pburs protein spans the amino acid sequence from region 21-141aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pburs

UniProt

Q9VJS7

Expression Region

21-141aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Drosophila melanogaster (Fruit fly)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LRYSQGTGDENCETLKSEIHLIKEEFDELGRMQRTCNADVIVNKCEGLCNSQVQPSVITPTGFLKECYCCRESFLKEKVITLTHCYDPDGTRLTSPEMGSMDIRLREPTECKCFKCGDFTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

tert-Butyl 5-Hydroxypentanoate
TRC-B693215-500MG 500 mg

tert-Butyl 5-Hydroxypentanoate

Sign In for Pricing
View Details
NAT8L Rabbit Polyclonal Antibody
TA368067 100 µL

NAT8L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2354), Biotin conjugate, 0.1mg/mL
BNCB2354-100 1x 100 µL

FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2354), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human MXRA8 activation kit by CRISPRa
GA110193 1 Kit

Human MXRA8 activation kit by CRISPRa

Sign In for Pricing
View Details
BLNK Rabbit Polyclonal Antibody
TA369834 100 µL

BLNK Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS505187 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details