Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PSMA1 protein

This Human PSMA1 protein spans the amino acid sequence from region 1-251aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PSMA1

UniProt

P25786

Expression Region

1-251aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of the full length of 1-263aa of His-tag and expression region is 1-251aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FastClick™ XFD647 Alkyne
72880-AAT 1 mg

FastClick™ XFD647 Alkyne

Sign In for Pricing
View Details
3M Sodium Acetate, pH5.2, Biotechnology Grade, 500ml
PB0461-500ml 500 mL

3M Sodium Acetate, pH5.2, Biotechnology Grade, 500ml

Sign In for Pricing
View Details
Cycotiamine
TRC-C988970-1G 1 g

Cycotiamine

Sign In for Pricing
View Details
ATG5 (Autophagy Marker) (ATG5/2553), CF647 conjugate, 0.1mg/mL
BNC472553-500 1x 500 µL

ATG5 (Autophagy Marker) (ATG5/2553), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Placental Alkaline Phosphatase 1/ALPP Protein (His Tag)
PKSH032058-01 10 µg

Recombinant Human Placental Alkaline Phosphatase 1/ALPP Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Placental Alkaline Phosphatase 1/ALPP Protein (His Tag)
PKSH032058-02 50 µg

Recombinant Human Placental Alkaline Phosphatase 1/ALPP Protein (His Tag)

Sign In for Pricing
View Details