Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PSMA1 protein

This Human PSMA1 protein spans the amino acid sequence from region 1-251aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PSMA1

UniProt

P25786

Expression Region

1-251aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of the full length of 1-263aa of His-tag and expression region is 1-251aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rrm2b Mouse Gene Knockout Kit (CRISPR)
KN515140 1 Kit

Rrm2b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IKK gamma (IKBKG) (NM_001099857) Human Recombinant Protein
TP318044L 1 mg

IKK gamma (IKBKG) (NM_001099857) Human Recombinant Protein

Sign In for Pricing
View Details
Human CGRP1 (Calcitonin Gene Related Peptide 1) ELISA Kit
E-EL-H0619-01 24 Tests

Human CGRP1 (Calcitonin Gene Related Peptide 1) ELISA Kit

Sign In for Pricing
View Details
Human CGRP1 (Calcitonin Gene Related Peptide 1) ELISA Kit
E-EL-H0619-02 48 Tests

Human CGRP1 (Calcitonin Gene Related Peptide 1) ELISA Kit

Sign In for Pricing
View Details
Human CGRP1 (Calcitonin Gene Related Peptide 1) ELISA Kit
E-EL-H0619-03 96 Tests

Human CGRP1 (Calcitonin Gene Related Peptide 1) ELISA Kit

Sign In for Pricing
View Details
TRP1 (Tyrosinase Related Protein 1) (TYRP1/807), CF647 conjugate, 0.1mg/mL
BNC470807-100 1x 100 µL

TRP1 (Tyrosinase Related Protein 1) (TYRP1/807), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details