Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLA2G2D protein

This Human PLA2G2D protein spans the amino acid sequence from region 22-145aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PLA2G2D

UniProt

Q9UNK4

Expression Region

22-145aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEM1 Human Over-expression Lysate
orb1367279 20 µg

SEM1 Human Over-expression Lysate

Sign In for Pricing
View Details
Digital Meters, Bench Type
1091780/5 1 Each

Digital Meters, Bench Type

Sign In for Pricing
View Details
RAD17 (Cell Cycle Checkpoint Protein RAD17, RAD 17, RAD-17) (AP) discontinued
301459-AP 100 µL

RAD17 (Cell Cycle Checkpoint Protein RAD17, RAD 17, RAD-17) (AP) discontinued

Sign In for Pricing
View Details
Recombinant Haemophilus parasuis serovar 5 Negative modulator of initiation of replication (seqA)
MBS1231525-01 0.02 mg (E-Coli)

Recombinant Haemophilus parasuis serovar 5 Negative modulator of initiation of replication (seqA)

Sign In for Pricing
View Details
Recombinant Haemophilus parasuis serovar 5 Negative modulator of initiation of replication (seqA)
MBS1231525-02 0.1 mg (E-Coli)

Recombinant Haemophilus parasuis serovar 5 Negative modulator of initiation of replication (seqA)

Sign In for Pricing
View Details
Recombinant Haemophilus parasuis serovar 5 Negative modulator of initiation of replication (seqA)
MBS1231525-03 0.02 mg (Yeast)

Recombinant Haemophilus parasuis serovar 5 Negative modulator of initiation of replication (seqA)

Sign In for Pricing
View Details