Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLA2G2D protein

This Human PLA2G2D protein spans the amino acid sequence from region 22-145aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PLA2G2D

UniProt

Q9UNK4

Expression Region

22-145aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(R)-2-((tert-Butoxycarbonyl)amino)-3-(4-fluorophenyl)propanoic acid
MBS3848188-01 1 g

(R)-2-((tert-Butoxycarbonyl)amino)-3-(4-fluorophenyl)propanoic acid

Sign In for Pricing
View Details
(R)-2-((tert-Butoxycarbonyl)amino)-3-(4-fluorophenyl)propanoic acid
MBS3848188-02 5 g

(R)-2-((tert-Butoxycarbonyl)amino)-3-(4-fluorophenyl)propanoic acid

Sign In for Pricing
View Details
(R)-2-((tert-Butoxycarbonyl)amino)-3-(4-fluorophenyl)propanoic acid
MBS3848188-03 5x 5 g

(R)-2-((tert-Butoxycarbonyl)amino)-3-(4-fluorophenyl)propanoic acid

Sign In for Pricing
View Details
Recombinant Rhizobium leguminosarum bv. viciae Zinc import ATP-binding protein ZnuC (znuC)
MBS1317119-01 0.02 mg (E-Coli)

Recombinant Rhizobium leguminosarum bv. viciae Zinc import ATP-binding protein ZnuC (znuC)

Sign In for Pricing
View Details
Recombinant Rhizobium leguminosarum bv. viciae Zinc import ATP-binding protein ZnuC (znuC)
MBS1317119-02 0.02 mg (Yeast)

Recombinant Rhizobium leguminosarum bv. viciae Zinc import ATP-binding protein ZnuC (znuC)

Sign In for Pricing
View Details
Recombinant Rhizobium leguminosarum bv. viciae Zinc import ATP-binding protein ZnuC (znuC)
MBS1317119-03 0.1 mg (E-Coli)

Recombinant Rhizobium leguminosarum bv. viciae Zinc import ATP-binding protein ZnuC (znuC)

Sign In for Pricing
View Details