Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PSAP protein

This Human PSAP protein spans the amino acid sequence from region 311-391aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PSAP

UniProt

P07602

Expression Region

311-391aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Saposin-C of GST-tag and expression region is 311-391aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Enterobacteria phage T4 DNA alpha-glucosyltransferase (agt)
MBS1165661-01 0.02 mg (Baculovirus)

Recombinant Enterobacteria phage T4 DNA alpha-glucosyltransferase (agt)

Sign In for Pricing
View Details
Recombinant Enterobacteria phage T4 DNA alpha-glucosyltransferase (agt)
MBS1165661-02 0.1 mg (Baculovirus)

Recombinant Enterobacteria phage T4 DNA alpha-glucosyltransferase (agt)

Sign In for Pricing
View Details
Recombinant Enterobacteria phage T4 DNA alpha-glucosyltransferase (agt)
MBS1165661-03 1 mg (Baculovirus)

Recombinant Enterobacteria phage T4 DNA alpha-glucosyltransferase (agt)

Sign In for Pricing
View Details
Recombinant Enterobacteria phage T4 DNA alpha-glucosyltransferase (agt)
MBS1165661-04 5x 1 mg (Baculovirus)

Recombinant Enterobacteria phage T4 DNA alpha-glucosyltransferase (agt)

Sign In for Pricing
View Details
Chicken LTbetaR (Lymphotoxin Beta Receptor) ELISA Kit
MBS2509606-01 24 Tests

Chicken LTbetaR (Lymphotoxin Beta Receptor) ELISA Kit

Sign In for Pricing
View Details
Chicken LTbetaR (Lymphotoxin Beta Receptor) ELISA Kit
MBS2509606-02 48 Tests

Chicken LTbetaR (Lymphotoxin Beta Receptor) ELISA Kit

Sign In for Pricing
View Details