Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PSAP protein

This Human PSAP protein spans the amino acid sequence from region 311-391aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PSAP

UniProt

P07602

Expression Region

311-391aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Saposin-C of GST-tag and expression region is 311-391aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALAS1 antibody
70R-2428 100 µL

ALAS1 antibody

Sign In for Pricing
View Details
Wnt10B, Recombinant, Human (Protein Wnt-10b, Protein Wnt-12, Wnt12)
W3038-10E 10 µg

Wnt10B, Recombinant, Human (Protein Wnt-10b, Protein Wnt-12, Wnt12)

Sign In for Pricing
View Details
MYO18B discontinued
391906 200 µL

MYO18B discontinued

Sign In for Pricing
View Details
SALL4 discontinued
531669-01 20 µL

SALL4 discontinued

Sign In for Pricing
View Details
SALL4 discontinued
531669-02 100 µL

SALL4 discontinued

Sign In for Pricing
View Details
NAT14 ORF Vector (Human) (pORF)
ORF006911 1.0 µg DNA

NAT14 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details