Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli PR protein

This E.coli PR protein spans the amino acid sequence from region 31-229aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PR

UniProt

P01238

Expression Region

31-229aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Sus scrofa (Pig)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 31-229aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AU040320 (NM_133886) Mouse Untagged Clone
MC205497 10 µg

AU040320 (NM_133886) Mouse Untagged Clone

Sign In for Pricing
View Details
Anti-Inhibin Alpha (INHa) Monoclonal Antibody
MBS2170466-01 25 Tests

Anti-Inhibin Alpha (INHa) Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Inhibin Alpha (INHa) Monoclonal Antibody
MBS2170466-02 50 Tests

Anti-Inhibin Alpha (INHa) Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Inhibin Alpha (INHa) Monoclonal Antibody
MBS2170466-03 100 Tests

Anti-Inhibin Alpha (INHa) Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Inhibin Alpha (INHa) Monoclonal Antibody
MBS2170466-04 200 Tests

Anti-Inhibin Alpha (INHa) Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Inhibin Alpha (INHa) Monoclonal Antibody
MBS2170466-05 500 Tests

Anti-Inhibin Alpha (INHa) Monoclonal Antibody

Sign In for Pricing
View Details