Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PRKRIR protein

This Human PRKRIR protein spans the amino acid sequence from region 612-761aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PRKRIR

UniProt

O43422

Expression Region

612-761aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of Isoform Long of His-SUMO-tag and expression region is 612-761aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC6A17 Recombinant Protein (Rat)
RP229748 100 µg

SLC6A17 Recombinant Protein (Rat)

Sign In for Pricing
View Details
6’-Hydroxy-amiodarone hydrochloride
XLC40107-01 1 mg

6’-Hydroxy-amiodarone hydrochloride

Sign In for Pricing
View Details
6’-Hydroxy-amiodarone hydrochloride
XLC40107-02 5 mg

6’-Hydroxy-amiodarone hydrochloride

Sign In for Pricing
View Details
6’-Hydroxy-amiodarone hydrochloride
XLC40107-03 10 mg

6’-Hydroxy-amiodarone hydrochloride

Sign In for Pricing
View Details
6’-Hydroxy-amiodarone hydrochloride
XLC40107-04 25 mg

6’-Hydroxy-amiodarone hydrochloride

Sign In for Pricing
View Details
6’-Hydroxy-amiodarone hydrochloride
XLC40107-05 50 mg

6’-Hydroxy-amiodarone hydrochloride

Sign In for Pricing
View Details