Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ZNRD1 protein

This Human ZNRD1 protein spans the amino acid sequence from region 1-126aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ZNRD1

UniProt

Q9P1U0

Expression Region

1-126aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VARS (Valyl-tRNA Synthetase, G7A, VARS1, VARS2) (FITC)
MBS6442911-01 0.1 mL

VARS (Valyl-tRNA Synthetase, G7A, VARS1, VARS2) (FITC)

Sign In for Pricing
View Details
VARS (Valyl-tRNA Synthetase, G7A, VARS1, VARS2) (FITC)
MBS6442911-02 5x 0.1 mL

VARS (Valyl-tRNA Synthetase, G7A, VARS1, VARS2) (FITC)

Sign In for Pricing
View Details
ZBTB49 Recombinant Protein (Human)
RP108209 100 µg

ZBTB49 Recombinant Protein (Human)

Sign In for Pricing
View Details
Anti-Rat OX-2 PE (Clone OX-2) (mouse IgG1)
MBS520397-01 0.05 mg

Anti-Rat OX-2 PE (Clone OX-2) (mouse IgG1)

Sign In for Pricing
View Details
Anti-Rat OX-2 PE (Clone OX-2) (mouse IgG1)
MBS520397-02 0.2 mg

Anti-Rat OX-2 PE (Clone OX-2) (mouse IgG1)

Sign In for Pricing
View Details
Anti-Rat OX-2 PE (Clone OX-2) (mouse IgG1)
MBS520397-03 5x 0.2 mg

Anti-Rat OX-2 PE (Clone OX-2) (mouse IgG1)

Sign In for Pricing
View Details