Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CUEDC2 protein

This Human CUEDC2 protein spans the amino acid sequence from region 1-226aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CUEDC2

UniProt

Q9H467

Expression Region

1-226aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEMLKEETRSSAAAAADTQDEATGAEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQMLVEGKEEGPAAWEGPNQDLPRRLRGPQKDELKSFILQKYMMVDSA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFF1 Recombinant Protein
OPCD07337-10UG 10 µg

TFF1 Recombinant Protein

Sign In for Pricing
View Details
SEH1L Antibody - middle region
MBS3222907-01 0.1 mL

SEH1L Antibody - middle region

Sign In for Pricing
View Details
SEH1L Antibody - middle region
MBS3222907-02 5x 0.1 mL

SEH1L Antibody - middle region

Sign In for Pricing
View Details
Desmin protein
30R-2138 100 ug

Desmin protein

Sign In for Pricing
View Details
Mir1931 Mouse MicroRNA Expression Plasmid (MI0009920)
SC400840 10 µg

Mir1931 Mouse MicroRNA Expression Plasmid (MI0009920)

Sign In for Pricing
View Details
Recombinant Roseobacter denitrificans Ribonuclease 3 (rnc)
MBS1316589-01 0.05 mg (E-Coli)

Recombinant Roseobacter denitrificans Ribonuclease 3 (rnc)

Sign In for Pricing
View Details