Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TRMT112 protein

This Human TRMT112 protein spans the amino acid sequence from region 1-125aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TRMT112

UniProt

Q9UI30

Expression Region

1-125aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD9 Antigen (CD9) Antibody
abx231507 100 µg

CD9 Antigen (CD9) Antibody

Sign In for Pricing
View Details
SNX12 (Protein Snx12, Sorting Nexin 12)
492448 100 µL

SNX12 (Protein Snx12, Sorting Nexin 12)

Sign In for Pricing
View Details
Rabbit Anti-GPR24 antibody
SL6626R-01 50 µL

Rabbit Anti-GPR24 antibody

Sign In for Pricing
View Details
Rabbit Anti-GPR24 antibody
SL6626R-02 100 µL

Rabbit Anti-GPR24 antibody

Sign In for Pricing
View Details
BIN2 Protein, Human, Recombinant (His)
TMPY-03992-01 5 µg

BIN2 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
BIN2 Protein, Human, Recombinant (His)
TMPY-03992-02 10 µg

BIN2 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details