Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TRMT112 protein

This Human TRMT112 protein spans the amino acid sequence from region 1-125aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TRMT112

UniProt

Q9UI30

Expression Region

1-125aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human NPHS1 Protein, N-His
bs-100173P-01 20 µg

Recombinant Human NPHS1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human NPHS1 Protein, N-His
bs-100173P-02 50 µg

Recombinant Human NPHS1 Protein, N-His

Sign In for Pricing
View Details
Porcine intercellular adhesion molecule 2, ICAM-2 GENLISA ELISA
KLP0261 96 Well

Porcine intercellular adhesion molecule 2, ICAM-2 GENLISA ELISA

Sign In for Pricing
View Details
Tssk6 (NM_032004) Mouse Tagged ORF Clone Lentiviral Particle
MR219953L3V 200 µL

Tssk6 (NM_032004) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PRKAG2 (NM_001040633) Human Tagged ORF Clone
RC216876 10 µg

PRKAG2 (NM_001040633) Human Tagged ORF Clone

Sign In for Pricing
View Details
TPBG CRISPR Knock Out 293T Cell Line (Human)
47345141 1x 10^6 Cells / 1.0 mL

TPBG CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details