Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ASH2L protein

This Human ASH2L protein spans the amino acid sequence from region 1-534aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ASH2L

UniProt

Q9UBL3

Expression Region

1-534aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

76.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDTQAGSVDEENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

7-AAD/CFSE Cell-Mediated Cytotoxicity Assay Kit
CST 72782S 1 Kit

7-AAD/CFSE Cell-Mediated Cytotoxicity Assay Kit

Sign In for Pricing
View Details
Rabbit Polyclonal ZMYM4 Antibody [PerCP]
NB100-95000PCP 0.1 mL

Rabbit Polyclonal ZMYM4 Antibody [PerCP]

Sign In for Pricing
View Details
HDAC, Mammalian, BioAssayTM Activity Assay Kit (Fluorometric) discontinued
167855 100 Tests

HDAC, Mammalian, BioAssayTM Activity Assay Kit (Fluorometric) discontinued

Sign In for Pricing
View Details
RIC8A Rabbit pAb
E2510556 100 µL

RIC8A Rabbit pAb

Sign In for Pricing
View Details
Ternidazole-d6 Hydrochloride (>90%)
TRC-T116502-10MG 10 mg

Ternidazole-d6 Hydrochloride (>90%)

Sign In for Pricing
View Details
Lentiviral human PROSER1 sgRNA gene knockout kit - Lentiviral human PROSER1 sgRNA gene knockout kit (100)
GTR15365443 1 Vial

Lentiviral human PROSER1 sgRNA gene knockout kit - Lentiviral human PROSER1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details