Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ASH2L protein

This Human ASH2L protein spans the amino acid sequence from region 1-534aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ASH2L

UniProt

Q9UBL3

Expression Region

1-534aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

76.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDTQAGSVDEENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CPA2
Pr22890-01 10 µg

Recombinant Mouse CPA2

Sign In for Pricing
View Details
Recombinant Mouse CPA2
Pr22890-02 50 µg

Recombinant Mouse CPA2

Sign In for Pricing
View Details
Recombinant Mouse CPA2
Pr22890-03 500 µg

Recombinant Mouse CPA2

Sign In for Pricing
View Details
Recombinant Mouse CPA2
Pr22890-04 1 mg

Recombinant Mouse CPA2

Sign In for Pricing
View Details
Sephs2 ORF Vector (Mouse) (pORF)
ORF056940 1.0 µg DNA

Sephs2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
SSB Polyclonal Antibody
E20-74425 100 µg

SSB Polyclonal Antibody

Sign In for Pricing
View Details