Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DLL3 protein

This Human DLL3 protein spans the amino acid sequence from region 27-492aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DLL3

UniProt

Q9NYJ7

Expression Region

27-492aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

64.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GSTA1/GSTA2/GSTA3/GSTA4/GSTA5 Antibody Picoband® (Dylight594 Conjugate)
PB9627-Dylight594 100 µg

Anti-GSTA1/GSTA2/GSTA3/GSTA4/GSTA5 Antibody Picoband® (Dylight594 Conjugate)

Sign In for Pricing
View Details
Ubl4a Mouse Pre-designed siRNA Set A
HY-RS22893 1 Set

Ubl4a Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
BMP5 (Bone Morphogenetic Protein 5, MGC34244) (Biotin)
243818-Biotin 100 µL

BMP5 (Bone Morphogenetic Protein 5, MGC34244) (Biotin)

Sign In for Pricing
View Details
SEMA7A Polyclonal Conjugated Antibody
MBS9454712-01 0.1 mL (Biotin)

SEMA7A Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
SEMA7A Polyclonal Conjugated Antibody
MBS9454712-02 0.1 mL (AF350)

SEMA7A Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
SEMA7A Polyclonal Conjugated Antibody
MBS9454712-03 0.1 mL (AF405)

SEMA7A Polyclonal Conjugated Antibody

Sign In for Pricing
View Details