Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Pla2g5 protein

This Rat Pla2g5 protein spans the amino acid sequence from region 21-137aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pla2g5

UniProt

P51433

Expression Region

21-137aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 21-137aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLLELKSMIEKVTGKNAVKNYGFYGCYCGWGGHGTPKDGTDWCCRMHDRCYGLLEEKHCAIRTQSYDYRFTQDLVICEHDSFCPVRLCACDRKLVYCLRRNLWSYNRLYQYYPNFLC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STIP1 (Stress-induced-phosphoprotein 1, STI1, Hsc70/Hsp90-organizing Protein, Hop, P60, Renal Carcinoma Antigen NY-REN-11, STI1L, Transformation-sensitive Protein IEF SSP 3521, IEF-SSP-3521) (AP) discontinued
133959-AP 100 µL

STIP1 (Stress-induced-phosphoprotein 1, STI1, Hsc70/Hsp90-organizing Protein, Hop, P60, Renal Carcinoma Antigen NY-REN-11, STI1L, Transformation-sensitive Protein IEF SSP 3521, IEF-SSP-3521) (AP) discontinued

Sign In for Pricing
View Details
Pacidamycin 2
orb3024355-01 50 mg

Pacidamycin 2

Sign In for Pricing
View Details
Pacidamycin 2
orb3024355-02 10 mg

Pacidamycin 2

Sign In for Pricing
View Details
Diflorasone diacetate
E4941-25mg 25 mg

Diflorasone diacetate

Sign In for Pricing
View Details
Connexin 35 (HRP)
MBS6243768-01 0.1 mL

Connexin 35 (HRP)

Sign In for Pricing
View Details
Connexin 35 (HRP)
MBS6243768-02 5x 0.1 mL

Connexin 35 (HRP)

Sign In for Pricing
View Details