Rat Pla2g5 protein
This Rat Pla2g5 protein spans the amino acid sequence from region 21-137aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Pla2g5
UniProt
P51433
Expression Region
21-137aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Rattus norvegicus (Rat)
Field of Research
Metabolism Research
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
29.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full length of His-SUMO-tag and expression region is 21-137aa
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
GLLELKSMIEKVTGKNAVKNYGFYGCYCGWGGHGTPKDGTDWCCRMHDRCYGLLEEKHCAIRTQSYDYRFTQDLVICEHDSFCPVRLCACDRKLVYCLRRNLWSYNRLYQYYPNFLC
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
133208-ML650 100 µL
SET (SET Nuclear Oncogene, Protein SET, 2PP2A, HLA-DR-associated Protein II, Inhibitor of Granzyme A-activated DNase, IGAAD, I2PP2A, I-2PP2A, IPP2A2, PHAPII, Phosphatase 2A Inhibitor I2PP2A, Template-activating Factor I, TAF-I, TAF-Ibeta) (MaxLight 650)
Sign In for Pricing
View Details 
307534-01 50 µg
Bacillus thuringiensis subsp. morrisoni Pesticidal crystal Protein cry1Fb
Sign In for Pricing
View Details 307534-02 100 µg
Bacillus thuringiensis subsp. morrisoni Pesticidal crystal Protein cry1Fb
Sign In for Pricing
View Details 
MBS2885765-01 48 Well
Pig Tumor necrosis factor receptor superfamily member 5 ELISA Kit
Sign In for Pricing
View Details MBS2885765-02 96 Well
Pig Tumor necrosis factor receptor superfamily member 5 ELISA Kit
Sign In for Pricing
View Details MBS2885765-03 5x 96 Well
Pig Tumor necrosis factor receptor superfamily member 5 ELISA Kit
Sign In for Pricing
View Details