Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Pla2g5 protein

This Rat Pla2g5 protein spans the amino acid sequence from region 21-137aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pla2g5

UniProt

P51433

Expression Region

21-137aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 21-137aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLLELKSMIEKVTGKNAVKNYGFYGCYCGWGGHGTPKDGTDWCCRMHDRCYGLLEEKHCAIRTQSYDYRFTQDLVICEHDSFCPVRLCACDRKLVYCLRRNLWSYNRLYQYYPNFLC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Camel Skeletal Muscle Actinin-alpha ELISA Kit
MBS088708-01 48 Well

Camel Skeletal Muscle Actinin-alpha ELISA Kit

Sign In for Pricing
View Details
Camel Skeletal Muscle Actinin-alpha ELISA Kit
MBS088708-02 96 Well

Camel Skeletal Muscle Actinin-alpha ELISA Kit

Sign In for Pricing
View Details
Camel Skeletal Muscle Actinin-alpha ELISA Kit
MBS088708-03 5x 96 Well

Camel Skeletal Muscle Actinin-alpha ELISA Kit

Sign In for Pricing
View Details
Camel Skeletal Muscle Actinin-alpha ELISA Kit
MBS088708-04 10x 96 Well

Camel Skeletal Muscle Actinin-alpha ELISA Kit

Sign In for Pricing
View Details
Cis-Tranylcypromine
CS-O-55497 1 Each

Cis-Tranylcypromine

Sign In for Pricing
View Details
ICOSLG (Inducible T-Cell Co-Stimulator Ligand, B7-H2, B7H2, B7RP-1, B7RP1, CD275, GL50, ICOS-L, ICOSL, KIAA0653, LICOS) (APC)
247353-APC 100 µL

ICOSLG (Inducible T-Cell Co-Stimulator Ligand, B7-H2, B7H2, B7RP-1, B7RP1, CD275, GL50, ICOS-L, ICOSL, KIAA0653, LICOS) (APC)

Sign In for Pricing
View Details