Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Pla2g5 protein

This Mouse Pla2g5 protein spans the amino acid sequence from region 21-137aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pla2g5

UniProt

P97391

Expression Region

21-137aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 21-137aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLLELKSMIEKVTGKNAFKNYGFYGCYCGWGGRGTPKDGTDWCCQMHDRCYGQLEEKDCAIRTQSYDYRYTNGLVICEHDSFCPMRLCACDRKLVYCLRRNLWTYNPLYQYYPNFLC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRF3 Mouse Monoclonal Antibody [Clone ID: 3F10]
AM05643PU-N 100 µg

IRF3 Mouse Monoclonal Antibody [Clone ID: 3F10]

Sign In for Pricing
View Details
5-Hydroxy L-Tryptophan
TRC-H975710-250MG 250 mg

5-Hydroxy L-Tryptophan

Sign In for Pricing
View Details
RING2 Recombinant Rabbit Monoclonal Antibody [JB38-41]
ET7107-07 100 µL

RING2 Recombinant Rabbit Monoclonal Antibody [JB38-41]

Sign In for Pricing
View Details
ASPG (NM_001080464) Human Over-expression Lysate
LC420721 20 µg

ASPG (NM_001080464) Human Over-expression Lysate

Sign In for Pricing
View Details
Syndig1l Mouse Gene Knockout Kit (CRISPR)
KN517055 1 Kit

Syndig1l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SNAP45 (SNAPC2) (NM_003083) Human Recombinant Protein
TP304157L 1 mg

SNAP45 (SNAPC2) (NM_003083) Human Recombinant Protein

Sign In for Pricing
View Details