Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine PIGR protein

This Bovine PIGR protein spans the amino acid sequence from region 400-599aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PIGR

UniProt

P81265

Expression Region

400-599aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of the full length of 19-757aa of His-tag and expression region is 399-599aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SRGLIKEQYEGRLALLTEPGNGTYTVILNQLTDQDTGFYWCVTDGDTRWISTVELKVVQGEPSLKVPKNVTAWLGEPLKLSCHFPCKFYSFEKYWCKWSNRGCSALPTQNDGPSQAFVSCDQNSQVVSLNLDTVTKEDEGWYWCGVKEGPRYGETAAVYVAVESRVKGSQGAKQVKAAPAGAAIQSRAGEIQNKALLDPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA replication licensing factor MCM2
orb1639153-01 50 µg

DNA replication licensing factor MCM2

Sign In for Pricing
View Details
DNA replication licensing factor MCM2
orb1639153-02 100 µg

DNA replication licensing factor MCM2

Sign In for Pricing
View Details
DNA replication licensing factor MCM2
orb1639153-03 1 mg

DNA replication licensing factor MCM2

Sign In for Pricing
View Details
Laminin Receptor Rabbit Polyclonal Antibody
orb339201-01 30 µL

Laminin Receptor Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Laminin Receptor Rabbit Polyclonal Antibody
orb339201-02 50 μL

Laminin Receptor Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Laminin Receptor Rabbit Polyclonal Antibody
orb339201-03 100 µL

Laminin Receptor Rabbit Polyclonal Antibody

Sign In for Pricing
View Details