Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PHPT1 protein

This Human PHPT1 protein spans the amino acid sequence from region 1-125aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PHPT1

UniProt

Q9NRX4

Expression Region

1-125aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 1-125aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thioredoxin (Trx) Spinach) ELISA Kit
H5698 96 Tests

Thioredoxin (Trx) Spinach) ELISA Kit

Sign In for Pricing
View Details
KCNMA1/BK channel Rabbit Polyclonal Antibody (Cy5)
orb915144 100 µL

KCNMA1/BK channel Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
ELISA kit for Human PLD1 (Phospholipase D1)
E-EL-H1595 96 Tests

ELISA kit for Human PLD1 (Phospholipase D1)

Sign In for Pricing
View Details
SCGN Rabbit Polyclonal Antibody (PerCP)
orb2541224 100 µL

SCGN Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Human Nucleoporin 85kDa (NUP85) ELISA Kit
orb1948976-01 48 Tests

Human Nucleoporin 85kDa (NUP85) ELISA Kit

Sign In for Pricing
View Details
Human Nucleoporin 85kDa (NUP85) ELISA Kit
orb1948976-02 96 Tests

Human Nucleoporin 85kDa (NUP85) ELISA Kit

Sign In for Pricing
View Details