Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PHPT1 protein

This Human PHPT1 protein spans the amino acid sequence from region 1-125aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PHPT1

UniProt

Q9NRX4

Expression Region

1-125aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 1-125aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Uridine-Cytidine Kinase 1 (UCK1) ELISA Kit
MBS9353860-01 48 Well

Canine Uridine-Cytidine Kinase 1 (UCK1) ELISA Kit

Sign In for Pricing
View Details
Canine Uridine-Cytidine Kinase 1 (UCK1) ELISA Kit
MBS9353860-02 96 Well

Canine Uridine-Cytidine Kinase 1 (UCK1) ELISA Kit

Sign In for Pricing
View Details
Canine Uridine-Cytidine Kinase 1 (UCK1) ELISA Kit
MBS9353860-03 5x 96 Well

Canine Uridine-Cytidine Kinase 1 (UCK1) ELISA Kit

Sign In for Pricing
View Details
Canine Uridine-Cytidine Kinase 1 (UCK1) ELISA Kit
MBS9353860-04 10x 96 Well

Canine Uridine-Cytidine Kinase 1 (UCK1) ELISA Kit

Sign In for Pricing
View Details
GRTP1 Rabbit Polyclonal Antibody
APRab11805-01 20 µL

GRTP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GRTP1 Rabbit Polyclonal Antibody
APRab11805-02 50 µL

GRTP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details