Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PHF5A protein

This Human PHF5A protein spans the amino acid sequence from region 1-110aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PHF5A

UniProt

Q7RTV0

Expression Region

1-110aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 1-110aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ndrg4 Pre-designed siRNA Set B
SI109168B 1 Each

Mouse Ndrg4 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Cis-Lacidipine photoadduct
RM-L030411-01 10 mg

Cis-Lacidipine photoadduct

Sign In for Pricing
View Details
Cis-Lacidipine photoadduct
RM-L030411-02 25 mg

Cis-Lacidipine photoadduct

Sign In for Pricing
View Details
Cis-Lacidipine photoadduct
RM-L030411-03 50 mg

Cis-Lacidipine photoadduct

Sign In for Pricing
View Details
Cis-Lacidipine photoadduct
RM-L030411-04 100 mg

Cis-Lacidipine photoadduct

Sign In for Pricing
View Details
Recombinant Human HIF1A Protein
MBS2569297-01 0.02 mg

Recombinant Human HIF1A Protein

Sign In for Pricing
View Details