Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PHF5A protein

This Human PHF5A protein spans the amino acid sequence from region 1-110aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PHF5A

UniProt

Q7RTV0

Expression Region

1-110aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 1-110aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAB1 (GRB2-associated Binder Protein 1, Growth Factor Receptor Bound Protein 2-associated Protein 1, GRB2-associated Binder 1) (MaxLight 405) discontinued
127079-ML405 100 µL

GAB1 (GRB2-associated Binder Protein 1, Growth Factor Receptor Bound Protein 2-associated Protein 1, GRB2-associated Binder 1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Vmn2r82 shRNA (UAS) - Lentiviral mouse Vmn2r82 shRNA (UAS, GFP) (100)
GTR15264501 1 Vial

Lentiviral mouse Vmn2r82 shRNA (UAS) - Lentiviral mouse Vmn2r82 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
YahH Antibody
orb829130 2 mg

YahH Antibody

Sign In for Pricing
View Details
TM9SF2, NT (TM9SF2, Transmembrane 9 superfamily member 2, p76) (APC) discontinued
042905-APC 200 µL

TM9SF2, NT (TM9SF2, Transmembrane 9 superfamily member 2, p76) (APC) discontinued

Sign In for Pricing
View Details
RPS19BP1 siRNA (Human)
orb1854208-01 15 nmol

RPS19BP1 siRNA (Human)

Sign In for Pricing
View Details
RPS19BP1 siRNA (Human)
orb1854208-02 30 nmol

RPS19BP1 siRNA (Human)

Sign In for Pricing
View Details