Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PHB protein

This Human PHB protein spans the amino acid sequence from region 1-272aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PHB

UniProt

P35232

Expression Region

1-272aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 1-272aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H2AC14 (NM_021066) Human Over-expression Lysate
LY412131 100 µg

H2AC14 (NM_021066) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Mycobacterium avium Phosphoglycerate kinase (pgk)
MBS1033532-01 0.02 mg (E-Coli)

Recombinant Mycobacterium avium Phosphoglycerate kinase (pgk)

Sign In for Pricing
View Details
Recombinant Mycobacterium avium Phosphoglycerate kinase (pgk)
MBS1033532-02 0.02 mg (Yeast)

Recombinant Mycobacterium avium Phosphoglycerate kinase (pgk)

Sign In for Pricing
View Details
Recombinant Mycobacterium avium Phosphoglycerate kinase (pgk)
MBS1033532-03 0.1 mg (E-Coli)

Recombinant Mycobacterium avium Phosphoglycerate kinase (pgk)

Sign In for Pricing
View Details
Recombinant Mycobacterium avium Phosphoglycerate kinase (pgk)
MBS1033532-04 0.1 mg (Yeast)

Recombinant Mycobacterium avium Phosphoglycerate kinase (pgk)

Sign In for Pricing
View Details
Recombinant Mycobacterium avium Phosphoglycerate kinase (pgk)
MBS1033532-05 0.02 mg (Baculovirus)

Recombinant Mycobacterium avium Phosphoglycerate kinase (pgk)

Sign In for Pricing
View Details