Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PGF protein

This Human PGF protein spans the amino acid sequence from region 19-170aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PGF

UniProt

P49763

Expression Region

19-170aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Isoform PlGF-2 of His-SUMO-tag and expression region is 19-170aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Lactoferrin ELISA Kit
CEK2468 96 Tests

Human Lactoferrin ELISA Kit

Sign In for Pricing
View Details
MIOX ORF Vector (Human) (pORF)
ORF006498 1.0 µg DNA

MIOX ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
FOXP2 Antibody
CSB-PA193153 100 µL

FOXP2 Antibody

Sign In for Pricing
View Details
Γ-[ (2-Aminoethyl) -imido]-AppNHp
NU-819-1 1 mg

Γ-[ (2-Aminoethyl) -imido]-AppNHp

Sign In for Pricing
View Details
Mouse Endothelial Progenitor Cells
RPC-368 5x 10^5

Mouse Endothelial Progenitor Cells

Sign In for Pricing
View Details
Fmoc-D-glutamic acid a-9-fluorenylmethyl ester 98+% (HPLC)
238236-01 100 mg

Fmoc-D-glutamic acid a-9-fluorenylmethyl ester 98+% (HPLC)

Sign In for Pricing
View Details