Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PGF protein

This Human PGF protein spans the amino acid sequence from region 19-170aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PGF

UniProt

P49763

Expression Region

19-170aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Isoform PlGF-2 of His-SUMO-tag and expression region is 19-170aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Phosphoglucomutase 1,PGM1 ELISA KIT
JOT-EK2209Hu-01 48 Well

Human Phosphoglucomutase 1,PGM1 ELISA KIT

Sign In for Pricing
View Details
Human Phosphoglucomutase 1,PGM1 ELISA KIT
JOT-EK2209Hu-02 96 Well

Human Phosphoglucomutase 1,PGM1 ELISA KIT

Sign In for Pricing
View Details
HEYL (Hairy/Enhancer-of-Split Related with YRPW Motif-like, HRT3, MGC12623, bHLHb33) (PE)
247049-PE 100 µL

HEYL (Hairy/Enhancer-of-Split Related with YRPW Motif-like, HRT3, MGC12623, bHLHb33) (PE)

Sign In for Pricing
View Details
Rat Fatty acid 2-hydroxylase, FA2H ELISA Kit
MBS9326863-01 48 Well

Rat Fatty acid 2-hydroxylase, FA2H ELISA Kit

Sign In for Pricing
View Details
Rat Fatty acid 2-hydroxylase, FA2H ELISA Kit
MBS9326863-02 96 Well

Rat Fatty acid 2-hydroxylase, FA2H ELISA Kit

Sign In for Pricing
View Details
Rat Fatty acid 2-hydroxylase, FA2H ELISA Kit
MBS9326863-03 5x 96 Well

Rat Fatty acid 2-hydroxylase, FA2H ELISA Kit

Sign In for Pricing
View Details