Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli def protein

This E.coli def protein spans the amino acid sequence from region 1-183aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Def

UniProt

P68826

Expression Region

1-183aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Staphylococcus aureus

Field of Research

Infectious Disease & Virology; Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-183aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAGLVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDAVEV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytohesin 1 (Cytohesin-1, CYTH1, D17S811E, PH, SEC7 and Coiled-coil Domain-containing Protein 1, PSCD1, SEC7 Homolog B2-1) (HRP)
131928-HRP 100 µL

Cytohesin 1 (Cytohesin-1, CYTH1, D17S811E, PH, SEC7 and Coiled-coil Domain-containing Protein 1, PSCD1, SEC7 Homolog B2-1) (HRP)

Sign In for Pricing
View Details
Phospho-CHEK2 (Ser33 + Ser35) Recombinant Antibody, Cy7 Conjugated
bsm-61589R-Cy7-TR 20 µL

Phospho-CHEK2 (Ser33 + Ser35) Recombinant Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
NANOS3 Antibody
A29333-100UG 100 µg

NANOS3 Antibody

Sign In for Pricing
View Details
Polyclonal Antibody to Interleukin 1 Receptor Accessory Protein (IL1RAP)
MBS2001569-01 0.1 mL

Polyclonal Antibody to Interleukin 1 Receptor Accessory Protein (IL1RAP)

Sign In for Pricing
View Details
Polyclonal Antibody to Interleukin 1 Receptor Accessory Protein (IL1RAP)
MBS2001569-02 0.2 mL

Polyclonal Antibody to Interleukin 1 Receptor Accessory Protein (IL1RAP)

Sign In for Pricing
View Details
Polyclonal Antibody to Interleukin 1 Receptor Accessory Protein (IL1RAP)
MBS2001569-03 0.5 mL

Polyclonal Antibody to Interleukin 1 Receptor Accessory Protein (IL1RAP)

Sign In for Pricing
View Details