Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli def protein

This E.coli def protein spans the amino acid sequence from region 1-183aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Def

UniProt

P68826

Expression Region

1-183aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Staphylococcus aureus

Field of Research

Infectious Disease & Virology; Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-183aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAGLVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDAVEV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Harpagoside 25mg
A13953-25 25 mg

Harpagoside 25mg

Sign In for Pricing
View Details
RPS10P26 CRISPRa sgRNA lentivector (set of three targets)(Human)
42031121 3x 1.0µg DNA

RPS10P26 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
hnRNP L (HNRNPL) Human Gene Knockout Kit (CRISPR)
KN409067 1 Kit

hnRNP L (HNRNPL) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Biotin anti-human CD273 (B7-DC, PD-L2)
GT12297 100 µg

Biotin anti-human CD273 (B7-DC, PD-L2)

Sign In for Pricing
View Details
MAVS (E-3) Alexa Fluor® 647
sc-166583 AF647 200 µg/mL

MAVS (E-3) Alexa Fluor® 647

Sign In for Pricing
View Details
H-Cit-AMC
4006058.1000 1 g

H-Cit-AMC

Sign In for Pricing
View Details