Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli def protein

This E. coli def protein spans the amino acid sequence from region 2-169aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Def

UniProt

P0A6K5

Expression Region

2-169aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia coli O157:H7

Field of Research

Infectious Disease & Virology; Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 2-169aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLKARA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Flg (Phospho Tyr766) Polyclonal Antibody
MBS9459037-01 0.05 mL

Flg (Phospho Tyr766) Polyclonal Antibody

Sign In for Pricing
View Details
Flg (Phospho Tyr766) Polyclonal Antibody
MBS9459037-02 0.1 mL

Flg (Phospho Tyr766) Polyclonal Antibody

Sign In for Pricing
View Details
Flg (Phospho Tyr766) Polyclonal Antibody
MBS9459037-03 5x 0.1 mL

Flg (Phospho Tyr766) Polyclonal Antibody

Sign In for Pricing
View Details
DDC, Human (Sf9, His)
HY-P704655 20 µg

DDC, Human (Sf9, His)

Sign In for Pricing
View Details
E.coli tnaA Recombinant Protein
PROTP0A853-20ug 20 µg

E.coli tnaA Recombinant Protein

Sign In for Pricing
View Details
Recombinant MERS-CoV Spike S2 Subunit protein
PROTK0BRG7-2-50ug 50 µg

Recombinant MERS-CoV Spike S2 Subunit protein

Sign In for Pricing
View Details