Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PARP11 protein

This Human PARP11 protein spans the amino acid sequence from region 2-331aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PARP11 C12orf6

UniProt

Q9NR21

Expression Region

2-331aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of the full length of 1-331aa of His-tag and expression region is 2-331aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FHKAEELFSKTTNNEVDDMDTSDTQWGWFYLAECGKWHMFQPDTNSQCSVSSEDIEKSFKTNPCGSISFTTSKFSYKIDFAEMKQMNLTTGKQRLIKRAPFSISAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTMDRNRIKRIQRIQNLDLWEFFCRKKAQLKKKRGVPQINEQMLFHGTSSEFVEAICIHNFDWRINGIHGAVFGKGTYFARDAAYSSRFCKDDIKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKDGSYVNLYDSCVDDTWNPKIFVVFDANQIYPEYLIDFH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Human MMP-1 (Matrix Metalloproteinase 1) ELISA Kit
MBS2571614-01 24 Tests (Limit 1)

Uncoated Human MMP-1 (Matrix Metalloproteinase 1) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human MMP-1 (Matrix Metalloproteinase 1) ELISA Kit
MBS2571614-02 5x 96 Tests

Uncoated Human MMP-1 (Matrix Metalloproteinase 1) ELISA Kit

Sign In for Pricing
View Details
3,4-seco-Olean-12-en-4-ol-3,28-dioic acid
HY-N9216 1 Each

3,4-seco-Olean-12-en-4-ol-3,28-dioic acid

Sign In for Pricing
View Details
SFTPH Recombinant Protein
OPCA01852-100UG 100 µg

SFTPH Recombinant Protein

Sign In for Pricing
View Details
Rotigotine-d7 Hydrochloride
CS-O-03341 1 Each

Rotigotine-d7 Hydrochloride

Sign In for Pricing
View Details
CD55 Protein Lysate (Mouse) with C-HA Tag
15553034 100 µg

CD55 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details