Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PARP11 protein

This Human PARP11 protein spans the amino acid sequence from region 2-331aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PARP11 C12orf6

UniProt

Q9NR21

Expression Region

2-331aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of the full length of 1-331aa of His-tag and expression region is 2-331aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FHKAEELFSKTTNNEVDDMDTSDTQWGWFYLAECGKWHMFQPDTNSQCSVSSEDIEKSFKTNPCGSISFTTSKFSYKIDFAEMKQMNLTTGKQRLIKRAPFSISAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTMDRNRIKRIQRIQNLDLWEFFCRKKAQLKKKRGVPQINEQMLFHGTSSEFVEAICIHNFDWRINGIHGAVFGKGTYFARDAAYSSRFCKDDIKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKDGSYVNLYDSCVDDTWNPKIFVVFDANQIYPEYLIDFH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tropomodulin 3 (TMOD3) ELISA Kit
MBS2020541-01 24 Strip Well

Mouse Tropomodulin 3 (TMOD3) ELISA Kit

Sign In for Pricing
View Details
Mouse Tropomodulin 3 (TMOD3) ELISA Kit
MBS2020541-02 48 Well

Mouse Tropomodulin 3 (TMOD3) ELISA Kit

Sign In for Pricing
View Details
Mouse Tropomodulin 3 (TMOD3) ELISA Kit
MBS2020541-03 96 Well

Mouse Tropomodulin 3 (TMOD3) ELISA Kit

Sign In for Pricing
View Details
Mouse Tropomodulin 3 (TMOD3) ELISA Kit
MBS2020541-04 5x 96 Well

Mouse Tropomodulin 3 (TMOD3) ELISA Kit

Sign In for Pricing
View Details
Mouse Tropomodulin 3 (TMOD3) ELISA Kit
MBS2020541-05 10x 96 Well

Mouse Tropomodulin 3 (TMOD3) ELISA Kit

Sign In for Pricing
View Details
Recombinant Pyrococcus furiosus Histidine biosynthesis bifunctional protein HisIE (hisI)
MBS1216598-01 0.02 mg (E-Coli)

Recombinant Pyrococcus furiosus Histidine biosynthesis bifunctional protein HisIE (hisI)

Sign In for Pricing
View Details