Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Parkin protein

This Human Parkin protein spans the amino acid sequence from region 1-465aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

E3 ubiquitin ligase protein, E3 ubiquitin protein ligase parkin protein, E3 ubiquitin-protein ligase parkin protein, LPRS 2 protein, LPRS2 protein, PARK 2 protein, PARK2 protein, Parkin 2 protein, Parkinson disease (autosomal recessive juvenile) 2 protein, Parkinson disease (autosomal recessive, juvenile) 2, parkin protein, Parkinson disease protein 2 protein, Parkinson juvenile disease protein 2 protein, Parkinson protein 2 E3 ubiquitin protein ligase protein, Parkinson protein 2, E3 ubiquitin protein ligase (parkin) protein, PRKN 2 protein, PRKN protein, PRKN2 protein

UniProt

O60260

Expression Region

1-465aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

67.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-465aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC99 Polyclonal Antibody
JOT-AP01295-01 20 µL

CCDC99 Polyclonal Antibody

Sign In for Pricing
View Details
CCDC99 Polyclonal Antibody
JOT-AP01295-02 50 μL

CCDC99 Polyclonal Antibody

Sign In for Pricing
View Details
CCDC99 Polyclonal Antibody
JOT-AP01295-03 100 µL

CCDC99 Polyclonal Antibody

Sign In for Pricing
View Details
genesig Easy kit for Equid Herpesvirus 4
Z-Path-EHV-4-EASY 50 Tests

genesig Easy kit for Equid Herpesvirus 4

Sign In for Pricing
View Details
Rhox4g sgRNA CRISPR Lentivector set (Mouse)
K3026801 3x 1.0 µg

Rhox4g sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Tspan5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4566906 1.0 µg DNA

Tspan5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details