Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ORC4 protein

This Human ORC4 protein spans the amino acid sequence from region 1-436aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ORC4

UniProt

O43929

Expression Region

1-436aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

66.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-436aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNLENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDISQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAEFPDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLHMLLMLALNRVTASHPFMTAVDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQKYPNCPTDVRQWATSSLSWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DIPA, ID (CCDC85B, DIPA, Coiled-coil domain-containing protein 85B, Hepatitis delta antigen-interacting protein A) (MaxLight 490)
MBS6292185-01 0.1 mL

DIPA, ID (CCDC85B, DIPA, Coiled-coil domain-containing protein 85B, Hepatitis delta antigen-interacting protein A) (MaxLight 490)

Sign In for Pricing
View Details
DIPA, ID (CCDC85B, DIPA, Coiled-coil domain-containing protein 85B, Hepatitis delta antigen-interacting protein A) (MaxLight 490)
MBS6292185-02 5x 0.1 mL

DIPA, ID (CCDC85B, DIPA, Coiled-coil domain-containing protein 85B, Hepatitis delta antigen-interacting protein A) (MaxLight 490)

Sign In for Pricing
View Details
PROS Polyclonal Antibody
RA34240-01 50 µL

PROS Polyclonal Antibody

Sign In for Pricing
View Details
PROS Polyclonal Antibody
RA34240-02 100 µL

PROS Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human IgG1 Fc Protein
orb2992939-01 10 µg

Recombinant Human IgG1 Fc Protein

Sign In for Pricing
View Details
Recombinant Human IgG1 Fc Protein
orb2992939-02 50 µg

Recombinant Human IgG1 Fc Protein

Sign In for Pricing
View Details