Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human OGT protein

This Human OGT protein spans the amino acid sequence from region 606-1022aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

OGT

UniProt

O15294

Expression Region

606-1022aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of His-SUMO-tag and expression region is 606-1022aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Colony Stimulating Factor Receptor, Granulocyte (GCSFR)
MBS2010959-01 0.01 mg

Recombinant Colony Stimulating Factor Receptor, Granulocyte (GCSFR)

Sign In for Pricing
View Details
Recombinant Colony Stimulating Factor Receptor, Granulocyte (GCSFR)
MBS2010959-02 0.05 mg

Recombinant Colony Stimulating Factor Receptor, Granulocyte (GCSFR)

Sign In for Pricing
View Details
Recombinant Colony Stimulating Factor Receptor, Granulocyte (GCSFR)
MBS2010959-03 0.1 mg

Recombinant Colony Stimulating Factor Receptor, Granulocyte (GCSFR)

Sign In for Pricing
View Details
Recombinant Colony Stimulating Factor Receptor, Granulocyte (GCSFR)
MBS2010959-04 0.2 mg

Recombinant Colony Stimulating Factor Receptor, Granulocyte (GCSFR)

Sign In for Pricing
View Details
Recombinant Colony Stimulating Factor Receptor, Granulocyte (GCSFR)
MBS2010959-05 0.5 mg

Recombinant Colony Stimulating Factor Receptor, Granulocyte (GCSFR)

Sign In for Pricing
View Details
Recombinant Colony Stimulating Factor Receptor, Granulocyte (GCSFR)
MBS2010959-06 1 mg

Recombinant Colony Stimulating Factor Receptor, Granulocyte (GCSFR)

Sign In for Pricing
View Details