Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NUP153 protein

This Human NUP153 protein spans the amino acid sequence from region 657-880aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NUP153

UniProt

P49790

Expression Region

657-880aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of the full length of Zinc finger 657-880aa of His-tag and expression region is 657-880aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KAGSSWQCDTCLLQNKVTDNKCIACQAAKLSPRDTAKQTGIETPNKSGKTTLSASGTGFGDKFKPVIGTWDCDTCLVQNKPEAIKCVACETPKPGTCVKRALTLTVVSESAETMTASSSSCTVTTGTLGFGDKFKRPIGSWECSVCCVSNNAEDNKCVSCMSEKPGSSVPASSSSTVPVSLPSGGSLGLEKFKKPEGSWDCELCLVQNKADSTKCLACESAKPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MC4 Receptor Rabbit monoclonal antibody
orb2297535-01 25 µL

MC4 Receptor Rabbit monoclonal antibody

Sign In for Pricing
View Details
MC4 Receptor Rabbit monoclonal antibody
orb2297535-02 50 µL

MC4 Receptor Rabbit monoclonal antibody

Sign In for Pricing
View Details
MC4 Receptor Rabbit monoclonal antibody
orb2297535-03 100 µL

MC4 Receptor Rabbit monoclonal antibody

Sign In for Pricing
View Details
Mouse Band 4.1-like protein 2 (EPB41L2) ELISA Kit
abx520361 96 Tests

Mouse Band 4.1-like protein 2 (EPB41L2) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Prostatic Acid Phosphatase/ACPP Antibody (SPM312) [Allophycocyanin]
NBP2-54475APC 100 µL

Mouse Monoclonal Prostatic Acid Phosphatase/ACPP Antibody (SPM312) [Allophycocyanin]

Sign In for Pricing
View Details
Olfr129 shRNA Plasmid (m)
sc-150448-SH 20 µg

Olfr129 shRNA Plasmid (m)

Sign In for Pricing
View Details