Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NTS protein

This Human NTS protein spans the amino acid sequence from region 24-143aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NTS

UniProt

P30990

Expression Region

24-143aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of the full length of Large neuromedin N chain of His-SUMO-tag and expression region is 24-143aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aminoacyl tRNA Synthetase Complex Interacting Multifunctional Protein 1 (AIMP1) Mouse ELISA Kit
B4427 96 Tests

Aminoacyl tRNA Synthetase Complex Interacting Multifunctional Protein 1 (AIMP1) Mouse ELISA Kit

Sign In for Pricing
View Details
GJB2 Knockout Cell Line-HaCat
RK-0334 1x 10^6

GJB2 Knockout Cell Line-HaCat

Sign In for Pricing
View Details
DREF Antibody
orb1321650 100 µL

DREF Antibody

Sign In for Pricing
View Details
Anti-ENPP4 Antibody Picoband® Cy3 Conjugated
A11668-Cy3 100 µg/Vial

Anti-ENPP4 Antibody Picoband® Cy3 Conjugated

Sign In for Pricing
View Details
Recombinant Human S6K1/RPS6KB1 Protein, N-His
orb2834495-01 20 µg

Recombinant Human S6K1/RPS6KB1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human S6K1/RPS6KB1 Protein, N-His
orb2834495-02 50 µg

Recombinant Human S6K1/RPS6KB1 Protein, N-His

Sign In for Pricing
View Details