Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NPHS1 protein

This Human NPHS1 protein spans the amino acid sequence from region 23-257aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NPHS1

UniProt

O60500

Expression Region

23-257aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of the full length of Extracellular of His-tag and expression region is 23-257aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QLAIPASVPRGFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPELVSPRVILSILVPPKLLLLTPEAGTMVTWVAGQEYVVNCVSGDAKPAPDITILLSGQTISDISANVNEGSQQKLFTVEATARVTPRSSDNRQLLVCEASSPALEAPIKASFTVNVLFPPGPPVIEWPGLDEGHVRA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dedd Mouse qPCR Primer Pair (NM_011615)
MP203444 200 Reactions

Dedd Mouse qPCR Primer Pair (NM_011615)

Sign In for Pricing
View Details
Anti-KRAS  (4E2)
YF-MA13938 100 ug

Anti-KRAS (4E2)

Sign In for Pricing
View Details
FLG sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0786906 1.0 µg DNA

FLG sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
TrkA Rabbit Polyclonal Antibody (Cy5.5)
orb1057684 100 µL

TrkA Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Orcein For Microscopy
189500010 10 mg

Orcein For Microscopy

Sign In for Pricing
View Details
PBS (pH 7.2)
BR0026 1 L (10X)

PBS (pH 7.2)

Sign In for Pricing
View Details