Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NPHS1 protein

This Human NPHS1 protein spans the amino acid sequence from region 23-257aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NPHS1

UniProt

O60500

Expression Region

23-257aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of the full length of Extracellular of His-tag and expression region is 23-257aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QLAIPASVPRGFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPELVSPRVILSILVPPKLLLLTPEAGTMVTWVAGQEYVVNCVSGDAKPAPDITILLSGQTISDISANVNEGSQQKLFTVEATARVTPRSSDNRQLLVCEASSPALEAPIKASFTVNVLFPPGPPVIEWPGLDEGHVRA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

7-Bromo-3-O-acetyl pregnenolone
263107-01 5 mg

7-Bromo-3-O-acetyl pregnenolone

Sign In for Pricing
View Details
7-Bromo-3-O-acetyl pregnenolone
263107-02 10 mg

7-Bromo-3-O-acetyl pregnenolone

Sign In for Pricing
View Details
7-Bromo-3-O-acetyl pregnenolone
263107-03 25 mg

7-Bromo-3-O-acetyl pregnenolone

Sign In for Pricing
View Details
7-Bromo-3-O-acetyl pregnenolone
263107-04 50 mg

7-Bromo-3-O-acetyl pregnenolone

Sign In for Pricing
View Details
7-Bromo-3-O-acetyl pregnenolone
263107-05 100 mg

7-Bromo-3-O-acetyl pregnenolone

Sign In for Pricing
View Details
DHPS Recombinant Protein (Mouse)
RP128924 100 µg

DHPS Recombinant Protein (Mouse)

Sign In for Pricing
View Details