Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PDRG1 protein

This Human PDRG1 protein spans the amino acid sequence from region 1-133aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PDRG1

UniProt

Q9NUG6

Expression Region

1-133aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLSPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVCFGNMFIKMPHPETKEMIEKDQDHLDKEIEKLRKQLKVKVNRLFEAQGKPELKGFNLNPLNQDELKALKVILKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 Spike Glycoprotein Antibody
abx461714-01 100 µg

SARS-CoV-2 Spike Glycoprotein Antibody

Sign In for Pricing
View Details
SARS-CoV-2 Spike Glycoprotein Antibody
abx461714-02 1 mg

SARS-CoV-2 Spike Glycoprotein Antibody

Sign In for Pricing
View Details
PCYT1B (Choline-phosphate Cytidylyltransferase B, Phosphorylcholine Transferase B, CTP:phosphocholine Cytidylyltransferase B, CCT B, CT B, CCT-beta, CCTB) (APC)
131024-APC 100 µL

PCYT1B (Choline-phosphate Cytidylyltransferase B, Phosphorylcholine Transferase B, CTP:phosphocholine Cytidylyltransferase B, CCT B, CT B, CCT-beta, CCTB) (APC)

Sign In for Pricing
View Details
MonkeypoxVirus (MPXV_USA_2022_MA001) A29L, mFc Tag
E24P006 0.1 mg

MonkeypoxVirus (MPXV_USA_2022_MA001) A29L, mFc Tag

Sign In for Pricing
View Details
AGPS (A-2) Alexa Fluor® 488
sc-374201 AF488 200 µg/mL

AGPS (A-2) Alexa Fluor® 488

Sign In for Pricing
View Details
IL6 Rabbit Polyclonal Antibody
orb628035-01 50 µg

IL6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details