Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human XPNPEP1 protein

This Human XPNPEP1 protein spans the amino acid sequence from region 2-623aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

XPNPEP1

UniProt

Q9NQW7

Expression Region

2-623aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

85.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPISKQH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Superoxide Dismutase 1 monoclonal antibody
orb1722848-01 50 µL

Superoxide Dismutase 1 monoclonal antibody

Sign In for Pricing
View Details
Superoxide Dismutase 1 monoclonal antibody
orb1722848-02 100 µL

Superoxide Dismutase 1 monoclonal antibody

Sign In for Pricing
View Details
Propionyl Histone H4 Antibody MiniAb Set
S0M1016 1 Kit

Propionyl Histone H4 Antibody MiniAb Set

Sign In for Pricing
View Details
Plant Poly ADP Ribose Polymerase 4 (PARP4) ELISA Kit
MBS9381685 Inquire

Plant Poly ADP Ribose Polymerase 4 (PARP4) ELISA Kit

Sign In for Pricing
View Details
MBD3 (F-11) Alexa Fluor® 546
sc-166319 AF546 200 µg/mL

MBD3 (F-11) Alexa Fluor® 546

Sign In for Pricing
View Details
PE anti-human CD106
GT08436 100 Tests

PE anti-human CD106

Sign In for Pricing
View Details