Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human XPNPEP1 protein

This Human XPNPEP1 protein spans the amino acid sequence from region 2-623aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

XPNPEP1

UniProt

Q9NQW7

Expression Region

2-623aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

85.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPISKQH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Donkey anti Goat IgG (heavy and light chains)
DoAG/IgG(H+L) 1 mL

Donkey anti Goat IgG (heavy and light chains)

Sign In for Pricing
View Details
SUHW4 Polyclonal Antibody
BT-AP08677-01 20 µL

SUHW4 Polyclonal Antibody

Sign In for Pricing
View Details
SUHW4 Polyclonal Antibody
BT-AP08677-02 50 µL

SUHW4 Polyclonal Antibody

Sign In for Pricing
View Details
SUHW4 Polyclonal Antibody
BT-AP08677-03 100 µL

SUHW4 Polyclonal Antibody

Sign In for Pricing
View Details
Pax6 (C-term) (Mouse) Rabbit pAb
E2618056 100 µL

Pax6 (C-term) (Mouse) Rabbit pAb

Sign In for Pricing
View Details
HHR23A Recombinant Rabbit mAb
BS46654-01 50 µL

HHR23A Recombinant Rabbit mAb

Sign In for Pricing
View Details