Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human XPNPEP1 protein

This Human XPNPEP1 protein spans the amino acid sequence from region 2-623aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

XPNPEP1

UniProt

Q9NQW7

Expression Region

2-623aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

85.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPISKQH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADM2 Protein Vector (Human) (pPM-C-HA)
PV061335 500 ng

ADM2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Phospho-PDGF Receptor beta (Tyr1021) Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-3322R-BF350-TR 20 µL

Phospho-PDGF Receptor beta (Tyr1021) Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
PDF Peptide
DF15764-BP 1 mg

PDF Peptide

Sign In for Pricing
View Details
Mouse Gm19619 activation kit by CRISPRa
GA219467 1 Kit

Mouse Gm19619 activation kit by CRISPRa

Sign In for Pricing
View Details
DPH3 (NM_206831) Human Over-expression Lysate
LY404231 100 µg

DPH3 (NM_206831) Human Over-expression Lysate

Sign In for Pricing
View Details
NAIP antibody
70R-11701 100 ug

NAIP antibody

Sign In for Pricing
View Details