Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli prpL protein

This E.coli prpL protein spans the amino acid sequence from region 212-462aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PrpL

UniProt

Q9HWK6

Expression Region

212-462aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGYRDGFGASGSCEVDAVCATQSGTRAYDNATAAVAKMVFTSSADGGSYICTGTLLNNGNSPKRQLFWSAAHCIEDQATAATLQTIWFYNTTQCYGDASTINQSVTVLTGGANILHRDAKRDTLLLELKRTPPAGVFYQGWSATPIANGSLGHDIHHPRGDAKKYSQGNVSAVGVTYDGHTALTRVDWPSAVVEGGSSGSGLLTVAGDGSYQLRGGLYGGPSYCGAPTSQRNDYFSDFSGVYSQISRYFAP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal CCR1 Antibody (002) [DyLight 405]
NBP2-89234V 0.1 mL

Rabbit Monoclonal CCR1 Antibody (002) [DyLight 405]

Sign In for Pricing
View Details
LHB Antibody
orb1410103-01 20 µg

LHB Antibody

Sign In for Pricing
View Details
LHB Antibody
orb1410103-02 100 µg

LHB Antibody

Sign In for Pricing
View Details
LHB Antibody
orb1410103-03 100 ug (without BSA and Azide)

LHB Antibody

Sign In for Pricing
View Details
RB1 (Retinoblastoma-associated Protein, pRb, Rb, PP110, P105-Rb) discontinued
R1660-05G5 100 µg

RB1 (Retinoblastoma-associated Protein, pRb, Rb, PP110, P105-Rb) discontinued

Sign In for Pricing
View Details
Human Prostatic Acid Phosphotase (ACPP) ELISA Kit
abx570320-01 96 Tests

Human Prostatic Acid Phosphotase (ACPP) ELISA Kit

Sign In for Pricing
View Details