Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NGFRAP1 protein

This Human NGFRAP1 protein spans the amino acid sequence from region 1-111aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NGFRAP1

UniProt

Q00994

Expression Region

1-111aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 1-111aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTA1 Monoclonal Antibody
E-AB-22222-01 20 µL

ACTA1 Monoclonal Antibody

Sign In for Pricing
View Details
ACTA1 Monoclonal Antibody
E-AB-22222-02 60 µL

ACTA1 Monoclonal Antibody

Sign In for Pricing
View Details
ACTA1 Monoclonal Antibody
E-AB-22222-03 120 µL

ACTA1 Monoclonal Antibody

Sign In for Pricing
View Details
ACTA1 Monoclonal Antibody
E-AB-22222-04 200 µL

ACTA1 Monoclonal Antibody

Sign In for Pricing
View Details
CD38 polyclonal antibody
BS7288-01 50 µL

CD38 polyclonal antibody

Sign In for Pricing
View Details
CD38 polyclonal antibody
BS7288-02 100 µL

CD38 polyclonal antibody

Sign In for Pricing
View Details