Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NGFRAP1 protein

This Human NGFRAP1 protein spans the amino acid sequence from region 1-111aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NGFRAP1

UniProt

Q00994

Expression Region

1-111aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 1-111aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA kit for Human CF? (Complement Factor ?)
E-EL-H0816 96 Tests

ELISA kit for Human CF? (Complement Factor ?)

Sign In for Pricing
View Details
Olr867 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
34752116 3x 1.0 µg

Olr867 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Putative glutaminase DH11.1 (DH11.1), partial
MBS1343915 Inquire

Recombinant Caenorhabditis elegans Putative glutaminase DH11.1 (DH11.1), partial

Sign In for Pricing
View Details
CRNN Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
16851064 1.0 µg DNA

CRNN Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rabbit Polyclonal Caspase-8 Antibody [CoraFluor 1]
NBP1-76610CL1 0.1 mL

Rabbit Polyclonal Caspase-8 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
Rat Prostate Secretory Protein 94 (PSP94) ELISA Kit
MBS9917144-01 48 Well

Rat Prostate Secretory Protein 94 (PSP94) ELISA Kit

Sign In for Pricing
View Details